| Basic Information | |
|---|---|
| Taxon OID | 3300007819 Open in IMG/M |
| Scaffold ID | Ga0104322_103846 Open in IMG/M |
| Source Dataset Name | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 Soapdenovo |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Princeton University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1036 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil → Permafrost Core Soil Microbial Communities From Svalbard, Norway |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Svalbard, Norway | |||||||
| Coordinates | Lat. (o) | 78.11096 | Long. (o) | 15.55294 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F096633 | Metagenome / Metatranscriptome | 104 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0104322_1038461 | F096633 | N/A | MTRQWKGAALAVAFVAAFVISIAFHSVVAAVTVLLSAVTVSYVIGIAWMRTSTHRERDKPQSLP* |
| ⦗Top⦘ |