Scaffold Ga0105545_1058264

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0105545_1058264

Scaffold Ga0105545_1058264

Overview

Basic Information
Taxon OID	3300007748 Open in IMG/M
Scaffold ID	Ga0105545_1058264 Open in IMG/M
Source Dataset Name	Marine sponge C. singaporensis microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'control', co15aic 200bp-25jan2016
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of New South Wales
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	552
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Coelocarteria Singaporensis (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location
Location Name	Upa-Upasina CO2 seeps 'control' site, Papua New Guinea
Coordinates	Lat. (^o)	-9.828217	Long. (^o)	150.820517	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085224	Metagenome	111	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0105545_10582641	F085224	N/A	GMMFHRTNAFGERRAGGFSNVAYGKGSMPDPNDGVNREALHYWLEKAEFYNWDVRYFDSPADLHEQLKAADFKAMHRDVLKTRARMDKIRDERWAEIKRDLAKTSSTPA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.