Scaffold Ga0105545_1035886

Overview

Basic Information

• Taxon OID: 3300007748
• Scaffold ID: Ga0105545_1035886
• Source Dataset Name: Marine sponge C. singaporensis microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'control', co15aic 200bp-25jan2016
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of New South Wales
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 755
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Coelocarteria Singaporensis (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location

• Location Name: Upa-Upasina CO2 seeps 'control' site, Papua New Guinea
• Coordinates
  • Lat. (^o): -9.828217
  • Long. (^o): 150.820517

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085224	Metagenome	111	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0105545_10358862	F085224	N/A	RPARLRHPRAHFRDYVTGISEAFNNFSYRDLLRFKAVVMFPYSVYSGVMIELIQMGVPMFYPSKRLLKRWDEKYGMMFHRTNAFGERRAGGFSNIAYGKDSAPDPNDSVNREALHYWLEKAEFYNWDVRYFDSPADLHEQLKAADFEAMHRDVLKTRARMDKIRDTRWAEIRRDLTKTSSTPA*