Scaffold Ga0105537_113030

Overview

Basic Information

• Taxon OID: 3300007659
• Scaffold ID: Ga0105537_113030
• Source Dataset Name: Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 160158126 reassembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1082
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location

• Location Name: USA: Maryland: Natonal Institute of Health
• Coordinates
  • Lat. (^o): 39.0042816
  • Long. (^o): -77.1012173

Associated Families

Family	Category	Number of Sequences	3D Structure?
F097527	Metagenome	104	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0105537_1130301	F097527	N/A	MIYFKMEKIGNSTHNKEKKTRSENLVFNTIPAAGGEPARPCGHWILGPARPPIP