Scaffold Ga0104854_10492196

Overview

Basic Information

• Taxon OID: 3300007643
• Scaffold ID: Ga0104854_10492196
• Source Dataset Name: Biofilm microbial communities from a marine aquaculture plant in North Sea, Germany
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Max Planck Institute for Evolutionary Biology
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 15894
• Total Scaffold Genes: 23
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 14 (60.87%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Biofilm Marine Aquaculture Plant → Biofilm Microbial Communities From A Marine Aquaculture Plant In North Sea, Germany

Source Dataset Sampling Location

• Location Name: Northern Germany
• Coordinates
  • Lat. (^o): 54.13
  • Long. (^o): 8.8

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001823	Metagenome / Metatranscriptome	630	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0104854_1049219623	F001823	N/A	AFDRDLICGEHYGQRPVQAPHQQAEHMAAPTSSVLTIKKTLANTEPSTHGT*