Basic Information | |
---|---|
Taxon OID | 3300007643 Open in IMG/M |
Scaffold ID | Ga0104854_10162756 Open in IMG/M |
Source Dataset Name | Biofilm microbial communities from a marine aquaculture plant in North Sea, Germany |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Max Planck Institute for Evolutionary Biology |
Sequencing Status | Finished |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 5767 |
Total Scaffold Genes | 9 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (77.78%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Microthrixaceae → Candidatus Microthrix → Candidatus Microthrix parvicella | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Biofilm Marine Aquaculture Plant → Biofilm Microbial Communities From A Marine Aquaculture Plant In North Sea, Germany |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Northern Germany | |||||||
Coordinates | Lat. (o) | 54.13 | Long. (o) | 8.8 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F006745 | Metagenome | 365 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0104854_101627565 | F006745 | GGA | MRTSERHRRASSAVVVYVIVLMSLQVFLVTVAAEAVLDDDEALAWATAGLSVALFLAAAAFLRYLRP* |
⦗Top⦘ |