Scaffold Ga0102781_1175261

Overview

Basic Information

• Taxon OID: 3300007591
• Scaffold ID: Ga0102781_1175261
• Source Dataset Name: Marine microbial communities from the Southern Atlantic ocean - KN S15 DCM_B metaT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 782
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Bathycoccaceae → Bathycoccus → Bathycoccus prasinos (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location

• Location Name: Southern Atlantic Ocean
• Coordinates
  • Lat. (^o): -28.2362
  • Long. (^o): -38.4949

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103879	Metagenome / Metatranscriptome	101	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0102781_11752611	F103879	N/A	QGNQNFVIDSQTCYDTYAHEFAEQLGDRLSPAGYRTQLERVDSGLEQHNPESRLMTHFRRVLQKDKTTVGIGKSWVSTTRSGLSRIVDSRGALKRKREKETRLSLRNWSYRQELALDRRTMYWRERKKMRLYSLEYNLNNVTDTDHNQNSRVTRLYFRDALIESRQKRQLRVSLEPSTYDTFATRKLVVRARKPVAEPSELLAGDIISVWFDWAKTA*