NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0099849_1000080

Scaffold Ga0099849_1000080


Overview

Basic Information
Taxon OID3300007539 Open in IMG/M
Scaffold IDGa0099849_1000080 Open in IMG/M
Source Dataset NameFreshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)35324
Total Scaffold Genes42 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (30.95%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Chesapeake Bay
CoordinatesLat. (o)38.9819Long. (o)-76.3716Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010801Metagenome299Y
F034891Metagenome173Y

Sequences

Protein IDFamilyRBSSequence
Ga0099849_100008014F034891N/AMPNVNGKKYAYTPKGIAQAKAEAKKKGKKLKYNG*
Ga0099849_100008041F010801GAGGMAITEDHDELFDRVRGNLGEHFTNYMFIVMDDDGDLFYDYSNFRVGRMLIKETHEDMEGKTDMIDVLWDAEEEDDEPEYE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.