| Basic Information | |
|---|---|
| Family ID | F034891 |
| Family Type | Metagenome |
| Number of Sequences | 173 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MPKVGSKHYAYTPKGMAKAKAAAKKSGKKVSYAKKK |
| Number of Associated Samples | 129 |
| Number of Associated Scaffolds | 173 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 77.27 % |
| % of genes near scaffold ends (potentially truncated) | 19.08 % |
| % of genes from short scaffolds (< 2000 bps) | 65.32 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (53.757 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (30.058 % of family members) |
| Environment Ontology (ENVO) | Unclassified (62.428 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (79.191 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.88% β-sheet: 12.50% Coil/Unstructured: 65.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 173 Family Scaffolds |
|---|---|---|
| PF03237 | Terminase_6N | 8.09 |
| PF00487 | FA_desaturase | 4.62 |
| PF13392 | HNH_3 | 1.16 |
| PF01521 | Fe-S_biosyn | 1.16 |
| PF03592 | Terminase_2 | 1.16 |
| PF05065 | Phage_capsid | 1.16 |
| PF04466 | Terminase_3 | 1.16 |
| PF05127 | Helicase_RecD | 0.58 |
| PF01391 | Collagen | 0.58 |
| PF08291 | Peptidase_M15_3 | 0.58 |
| PF07102 | YbcO | 0.58 |
| PF12236 | Head-tail_con | 0.58 |
| PF00082 | Peptidase_S8 | 0.58 |
| PF01171 | ATP_bind_3 | 0.58 |
| PF05497 | Destabilase | 0.58 |
| PF13884 | Peptidase_S74 | 0.58 |
| PF01612 | DNA_pol_A_exo1 | 0.58 |
| PF11651 | P22_CoatProtein | 0.58 |
| PF05396 | Phage_T7_Capsid | 0.58 |
| PF00118 | Cpn60_TCP1 | 0.58 |
| PF05866 | RusA | 0.58 |
| PF00149 | Metallophos | 0.58 |
| PF08401 | ArdcN | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 173 Family Scaffolds |
|---|---|---|---|
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 4.62 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 4.62 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 1.16 |
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 1.16 |
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 1.16 |
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 1.16 |
| COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 1.16 |
| COG1444 | tRNA(Met) C34 N-acetyltransferase TmcA | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 0.58 |
| COG4227 | Antirestriction protein ArdC | Replication, recombination and repair [L] | 0.58 |
| COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 0.58 |
| COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 0.58 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.58 |
| COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 53.76 % |
| All Organisms | root | All Organisms | 46.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10052339 | All Organisms → cellular organisms → Bacteria | 1778 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10180358 | Not Available | 693 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10202529 | Not Available | 610 | Open in IMG/M |
| 3300001348|JGI20154J14316_10142188 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300002525|JGI24926J35533_107301 | Not Available | 670 | Open in IMG/M |
| 3300002527|JGI24926J35532_107301 | Not Available | 670 | Open in IMG/M |
| 3300002835|B570J40625_100025723 | Not Available | 9584 | Open in IMG/M |
| 3300004829|Ga0068515_113293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1030 | Open in IMG/M |
| 3300005512|Ga0074648_1024372 | All Organisms → cellular organisms → Bacteria | 3247 | Open in IMG/M |
| 3300005512|Ga0074648_1157088 | Not Available | 681 | Open in IMG/M |
| 3300005528|Ga0068872_10006901 | Not Available | 8369 | Open in IMG/M |
| 3300005969|Ga0066369_10231995 | Not Available | 598 | Open in IMG/M |
| 3300006025|Ga0075474_10029024 | All Organisms → cellular organisms → Bacteria | 1957 | Open in IMG/M |
| 3300006025|Ga0075474_10090894 | Not Available | 993 | Open in IMG/M |
| 3300006750|Ga0098058_1049024 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300006750|Ga0098058_1197208 | Not Available | 524 | Open in IMG/M |
| 3300006793|Ga0098055_1108478 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300006802|Ga0070749_10032436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3247 | Open in IMG/M |
| 3300006802|Ga0070749_10053236 | All Organisms → Viruses → Predicted Viral | 2461 | Open in IMG/M |
| 3300006802|Ga0070749_10058200 | Not Available | 2337 | Open in IMG/M |
| 3300006802|Ga0070749_10066023 | All Organisms → Viruses → Predicted Viral | 2177 | Open in IMG/M |
| 3300006802|Ga0070749_10177791 | Not Available | 1227 | Open in IMG/M |
| 3300006802|Ga0070749_10545229 | Not Available | 629 | Open in IMG/M |
| 3300006803|Ga0075467_10346012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 782 | Open in IMG/M |
| 3300006810|Ga0070754_10230741 | Not Available | 852 | Open in IMG/M |
| 3300006868|Ga0075481_10354438 | Not Available | 506 | Open in IMG/M |
| 3300006869|Ga0075477_10267109 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 686 | Open in IMG/M |
| 3300006916|Ga0070750_10174575 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300006919|Ga0070746_10051922 | All Organisms → Viruses → Predicted Viral | 2137 | Open in IMG/M |
| 3300006919|Ga0070746_10097801 | All Organisms → Viruses → Predicted Viral | 1467 | Open in IMG/M |
| 3300006919|Ga0070746_10545215 | Not Available | 503 | Open in IMG/M |
| 3300007344|Ga0070745_1078825 | All Organisms → Viruses → Predicted Viral | 1312 | Open in IMG/M |
| 3300007344|Ga0070745_1251873 | Not Available | 638 | Open in IMG/M |
| 3300007345|Ga0070752_1293224 | Not Available | 621 | Open in IMG/M |
| 3300007346|Ga0070753_1212002 | Not Available | 713 | Open in IMG/M |
| 3300007538|Ga0099851_1033065 | All Organisms → Viruses | 2065 | Open in IMG/M |
| 3300007538|Ga0099851_1140225 | Not Available | 905 | Open in IMG/M |
| 3300007538|Ga0099851_1361513 | Not Available | 505 | Open in IMG/M |
| 3300007539|Ga0099849_1000080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp. | 35324 | Open in IMG/M |
| 3300007539|Ga0099849_1031697 | All Organisms → Viruses → Predicted Viral | 2260 | Open in IMG/M |
| 3300007539|Ga0099849_1091225 | All Organisms → Viruses → Predicted Viral | 1222 | Open in IMG/M |
| 3300007539|Ga0099849_1093339 | All Organisms → Viruses → Predicted Viral | 1205 | Open in IMG/M |
| 3300007540|Ga0099847_1078751 | All Organisms → Viruses → Predicted Viral | 1016 | Open in IMG/M |
| 3300007540|Ga0099847_1128734 | Not Available | 760 | Open in IMG/M |
| 3300007541|Ga0099848_1346047 | Not Available | 501 | Open in IMG/M |
| 3300007960|Ga0099850_1009409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Maricaulales → Maricaulaceae → Maricaulis → unclassified Maricaulis → Maricaulis sp. | 4460 | Open in IMG/M |
| 3300007963|Ga0110931_1045322 | All Organisms → Viruses → Predicted Viral | 1328 | Open in IMG/M |
| 3300008107|Ga0114340_1077201 | Not Available | 2097 | Open in IMG/M |
| 3300008107|Ga0114340_1127372 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300008217|Ga0114899_1029134 | All Organisms → Viruses → Predicted Viral | 2073 | Open in IMG/M |
| 3300008217|Ga0114899_1065378 | All Organisms → Viruses → Predicted Viral | 1269 | Open in IMG/M |
| 3300009108|Ga0117920_1170820 | Not Available | 740 | Open in IMG/M |
| 3300009124|Ga0118687_10000039 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 51969 | Open in IMG/M |
| 3300009124|Ga0118687_10011695 | All Organisms → Viruses | 2893 | Open in IMG/M |
| 3300009149|Ga0114918_10053171 | Not Available | 2707 | Open in IMG/M |
| 3300009173|Ga0114996_10785876 | Not Available | 690 | Open in IMG/M |
| 3300009442|Ga0115563_1150853 | Not Available | 934 | Open in IMG/M |
| 3300009467|Ga0115565_10054399 | Not Available | 1949 | Open in IMG/M |
| 3300009593|Ga0115011_11394137 | Not Available | 614 | Open in IMG/M |
| 3300009706|Ga0115002_10156881 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1802 | Open in IMG/M |
| 3300009706|Ga0115002_10434864 | Not Available | 965 | Open in IMG/M |
| 3300009706|Ga0115002_10450696 | Not Available | 943 | Open in IMG/M |
| 3300010153|Ga0098059_1384008 | Not Available | 531 | Open in IMG/M |
| 3300010296|Ga0129348_1007477 | All Organisms → Viruses | 3975 | Open in IMG/M |
| 3300010296|Ga0129348_1273414 | Not Available | 566 | Open in IMG/M |
| 3300010297|Ga0129345_1250447 | Not Available | 619 | Open in IMG/M |
| 3300010299|Ga0129342_1149064 | Not Available | 853 | Open in IMG/M |
| 3300010370|Ga0129336_10213624 | All Organisms → Viruses → Predicted Viral | 1094 | Open in IMG/M |
| 3300010392|Ga0118731_106071700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
| 3300010883|Ga0133547_10227875 | Not Available | 3937 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10001324 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 36353 | Open in IMG/M |
| 3300017697|Ga0180120_10056230 | Not Available | 1764 | Open in IMG/M |
| 3300017697|Ga0180120_10120581 | All Organisms → Viruses → Predicted Viral | 1128 | Open in IMG/M |
| 3300017710|Ga0181403_1004843 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2956 | Open in IMG/M |
| 3300017743|Ga0181402_1160798 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300017773|Ga0181386_1186194 | Not Available | 627 | Open in IMG/M |
| 3300017788|Ga0169931_10269053 | All Organisms → Viruses → Predicted Viral | 1372 | Open in IMG/M |
| 3300017818|Ga0181565_10587892 | Not Available | 715 | Open in IMG/M |
| 3300017824|Ga0181552_10273439 | Not Available | 842 | Open in IMG/M |
| 3300017824|Ga0181552_10444229 | Not Available | 616 | Open in IMG/M |
| 3300017950|Ga0181607_10159937 | Not Available | 1359 | Open in IMG/M |
| 3300017951|Ga0181577_10001409 | All Organisms → cellular organisms → Bacteria | 19322 | Open in IMG/M |
| 3300017951|Ga0181577_10001832 | All Organisms → cellular organisms → Bacteria | 16850 | Open in IMG/M |
| 3300017951|Ga0181577_10191214 | All Organisms → Viruses → Predicted Viral | 1372 | Open in IMG/M |
| 3300017952|Ga0181583_10815012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
| 3300017986|Ga0181569_10373586 | Not Available | 979 | Open in IMG/M |
| 3300018049|Ga0181572_10365600 | Not Available | 906 | Open in IMG/M |
| 3300018421|Ga0181592_10264402 | All Organisms → Viruses → Predicted Viral | 1257 | Open in IMG/M |
| 3300018424|Ga0181591_10709078 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 707 | Open in IMG/M |
| 3300019750|Ga0194000_1001343 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 2241 | Open in IMG/M |
| 3300019751|Ga0194029_1003353 | Not Available | 2105 | Open in IMG/M |
| 3300019765|Ga0194024_1004029 | All Organisms → cellular organisms → Bacteria | 3017 | Open in IMG/M |
| 3300019765|Ga0194024_1073183 | Not Available | 771 | Open in IMG/M |
| 3300020459|Ga0211514_10278969 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 823 | Open in IMG/M |
| 3300020460|Ga0211486_10191896 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300020570|Ga0208465_1000160 | Not Available | 21746 | Open in IMG/M |
| 3300021378|Ga0213861_10006748 | All Organisms → cellular organisms → Bacteria | 9020 | Open in IMG/M |
| 3300021379|Ga0213864_10010864 | All Organisms → Viruses | 4047 | Open in IMG/M |
| 3300021791|Ga0226832_10050827 | All Organisms → Viruses → Predicted Viral | 1429 | Open in IMG/M |
| 3300021957|Ga0222717_10113788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1681 | Open in IMG/M |
| 3300021958|Ga0222718_10351079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 750 | Open in IMG/M |
| 3300021958|Ga0222718_10397771 | Not Available | 689 | Open in IMG/M |
| 3300021959|Ga0222716_10171237 | Not Available | 1399 | Open in IMG/M |
| 3300021959|Ga0222716_10537460 | Not Available | 650 | Open in IMG/M |
| 3300021960|Ga0222715_10141634 | Not Available | 1501 | Open in IMG/M |
| 3300021960|Ga0222715_10289455 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 935 | Open in IMG/M |
| 3300021960|Ga0222715_10522262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 626 | Open in IMG/M |
| 3300021964|Ga0222719_10200803 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1363 | Open in IMG/M |
| 3300022050|Ga0196883_1006375 | All Organisms → Viruses → Predicted Viral | 1377 | Open in IMG/M |
| 3300022050|Ga0196883_1006882 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
| 3300022067|Ga0196895_1017750 | Not Available | 786 | Open in IMG/M |
| 3300022068|Ga0212021_1048710 | Not Available | 857 | Open in IMG/M |
| 3300022198|Ga0196905_1001051 | Not Available | 10701 | Open in IMG/M |
| 3300022308|Ga0224504_10221547 | All Organisms → Viruses | 781 | Open in IMG/M |
| 3300022921|Ga0255765_1172606 | Not Available | 992 | Open in IMG/M |
| 3300023175|Ga0255777_10647891 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 515 | Open in IMG/M |
| 3300024328|Ga0228635_1030573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1595 | Open in IMG/M |
| (restricted) 3300024518|Ga0255048_10008014 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5720 | Open in IMG/M |
| 3300025083|Ga0208791_1031457 | All Organisms → Viruses → Predicted Viral | 1002 | Open in IMG/M |
| 3300025112|Ga0209349_1011724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → unclassified Marinobacter → Marinobacter sp. | 3355 | Open in IMG/M |
| 3300025128|Ga0208919_1080348 | All Organisms → Viruses → Predicted Viral | 1070 | Open in IMG/M |
| 3300025132|Ga0209232_1071817 | All Organisms → Viruses → Predicted Viral | 1214 | Open in IMG/M |
| 3300025151|Ga0209645_1079114 | Not Available | 1096 | Open in IMG/M |
| 3300025168|Ga0209337_1043595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Butyrivibrio → unclassified Butyrivibrio → Butyrivibrio sp. AE2032 | 2379 | Open in IMG/M |
| 3300025264|Ga0208029_1030768 | Not Available | 1248 | Open in IMG/M |
| 3300025301|Ga0208450_1086256 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8 | 705 | Open in IMG/M |
| 3300025543|Ga0208303_1073842 | Not Available | 769 | Open in IMG/M |
| 3300025610|Ga0208149_1003793 | Not Available | 5112 | Open in IMG/M |
| 3300025646|Ga0208161_1115906 | Not Available | 715 | Open in IMG/M |
| 3300025671|Ga0208898_1147582 | Not Available | 640 | Open in IMG/M |
| 3300025674|Ga0208162_1098971 | Not Available | 871 | Open in IMG/M |
| 3300025751|Ga0208150_1044944 | Not Available | 1517 | Open in IMG/M |
| 3300025769|Ga0208767_1099244 | Not Available | 1170 | Open in IMG/M |
| 3300025769|Ga0208767_1278378 | Not Available | 504 | Open in IMG/M |
| 3300025818|Ga0208542_1076851 | Not Available | 994 | Open in IMG/M |
| 3300025889|Ga0208644_1345393 | Not Available | 570 | Open in IMG/M |
| 3300027793|Ga0209972_10158798 | Not Available | 1077 | Open in IMG/M |
| 3300027839|Ga0209403_10084105 | All Organisms → Viruses → Predicted Viral | 2167 | Open in IMG/M |
| 3300027847|Ga0209402_10043793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3276 | Open in IMG/M |
| 3300027906|Ga0209404_10765354 | Not Available | 654 | Open in IMG/M |
| 3300027917|Ga0209536_100106578 | All Organisms → cellular organisms → Bacteria | 3563 | Open in IMG/M |
| 3300028022|Ga0256382_1005451 | All Organisms → Viruses → Predicted Viral | 2155 | Open in IMG/M |
| 3300028022|Ga0256382_1020896 | All Organisms → Viruses → Predicted Viral | 1386 | Open in IMG/M |
| 3300031565|Ga0307379_10405888 | All Organisms → Viruses → Predicted Viral | 1304 | Open in IMG/M |
| 3300031605|Ga0302132_10004506 | Not Available | 7871 | Open in IMG/M |
| 3300031605|Ga0302132_10168988 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1069 | Open in IMG/M |
| 3300031787|Ga0315900_10052826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4269 | Open in IMG/M |
| 3300031802|Ga0310123_10666468 | Not Available | 635 | Open in IMG/M |
| 3300031886|Ga0315318_10367793 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 824 | Open in IMG/M |
| 3300034104|Ga0335031_0000336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 37168 | Open in IMG/M |
| 3300034111|Ga0335063_0218188 | All Organisms → Viruses → Predicted Viral | 1061 | Open in IMG/M |
| 3300034200|Ga0335065_0149038 | All Organisms → Viruses → Predicted Viral | 1558 | Open in IMG/M |
| 3300034374|Ga0348335_100173 | Not Available | 914 | Open in IMG/M |
| 3300034374|Ga0348335_139965 | Not Available | 681 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 30.06% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 13.87% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 9.25% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 5.78% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 4.05% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.89% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.89% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 2.89% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 2.31% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.73% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.73% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.73% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.73% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.16% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.16% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 1.16% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.16% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.16% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.16% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 1.16% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 1.16% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.58% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.58% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.58% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.58% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.58% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.58% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.58% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.58% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.58% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.58% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.58% |
| Marine Water | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water | 0.58% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 0.58% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.58% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.58% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001348 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002525 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C27A4_80 | Environmental | Open in IMG/M |
| 3300002527 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C27A4_80 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004829 | Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVs | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005747 | Seawater microbial communities from Vineyard Sound, MA, USA - control T14 | Environmental | Open in IMG/M |
| 3300005969 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_Bottom_ad_4513_LV_A | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008217 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009108 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 234m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009442 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 | Environmental | Open in IMG/M |
| 3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009706 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019708 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_2-3_MG | Environmental | Open in IMG/M |
| 3300019750 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States - FLT_6-7_MG | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020459 | Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095) | Environmental | Open in IMG/M |
| 3300020460 | Marine microbial communities from Tara Oceans - TARA_A100001037 (ERX555931-ERR599097) | Environmental | Open in IMG/M |
| 3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021791 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022050 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3) | Environmental | Open in IMG/M |
| 3300022067 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022308 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022921 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300023175 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG | Environmental | Open in IMG/M |
| 3300024328 | Seawater microbial communities from Monterey Bay, California, United States - 44D | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025264 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025301 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025640 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027839 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 (SPAdes) | Environmental | Open in IMG/M |
| 3300027847 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031605 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_32.1 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031802 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_AW_1057 | Environmental | Open in IMG/M |
| 3300031886 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 3416 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_100523392 | 3300000116 | Marine | MPKVGKKHYAYTKXGMAKAKAAAKKSGKKVMYAXKK* |
| DelMOSpr2010_101803582 | 3300000116 | Marine | MPKVGSKHYSYTPKGMAMAKAAAKKKGVKVQYGKKKSKK* |
| DelMOWin2010_102025292 | 3300000117 | Marine | MPKVGKKHYSYTPKGMAQAKAAAKKXGVKVSYKKKKK* |
| JGI20154J14316_101421881 | 3300001348 | Pelagic Marine | MPKVGTKHYPYTPKGMAMAKNTAKRKGLTVQYGKKK* |
| KVRMV2_1000282994 | 3300002231 | Marine Sediment | MPKVGXXKFPYSKAGMAKAKNYAKKTGKKIKKKY* |
| JGI24926J35533_1073011 | 3300002525 | Marine | MPKVGNKHYAYTAKGMAKAKAAAKKSGKKVSYGKRKRRT* |
| JGI24926J35532_1073011 | 3300002527 | Marine | MPKVGNKHYAYTAKGMAKAKAAAKKSGKKVSYGKRKRRT |
| B570J40625_10002572314 | 3300002835 | Freshwater | MPKVGSKHYAYTPKGKAAAQKAAAQKGMKVQYASKARKRAK* |
| Ga0068515_1132932 | 3300004829 | Marine Water | MEIMMPKVGSKHYAYTPKGMAKAKAAAKKSGKKVSYAKKAKK* |
| Ga0074648_10243724 | 3300005512 | Saline Water And Sediment | MPKVGKKEYPYTAKGMAMAKAAAKKKGTKVSYGKKKK* |
| Ga0074648_11570881 | 3300005512 | Saline Water And Sediment | MPKVGKKHYPYTAKGMAMAKAAAKKKGTKVSYGKKKK* |
| Ga0068872_100069018 | 3300005528 | Freshwater Lake | MPKVGKKEYAYTPKGMAQAKADAKKKGMKVQYGKSKKGGK* |
| Ga0076924_11811552 | 3300005747 | Marine | MPKVGNKTYPYTAKGMKAAKSSAKKSGKKVTYKKK* |
| Ga0066369_102319952 | 3300005969 | Marine | VPKVGSKNYPYSKKGMAQAKADAKKRGVAVSYGKKKSGKKGR* |
| Ga0075474_100055847 | 3300006025 | Aqueous | MPKVGKKHYAYTKAGMAKAKAAAKKTGKKVSYAKKK* |
| Ga0075474_100290242 | 3300006025 | Aqueous | MPKVGKKEYPYTAKGMAMAKAAAKKKGTKVSYGRKKKK* |
| Ga0075474_100908943 | 3300006025 | Aqueous | MPKVGKKHYAYTKAGMAKAKAAAKKSGKKVMYAKKK* |
| Ga0075474_102736162 | 3300006025 | Aqueous | MPKVGNKKYAYTKAGMAKANAAAKKSGKKVVKKKS* |
| Ga0098058_10490241 | 3300006750 | Marine | MPKVGKKHYPYTHAGKRAAKEAAKKQGLKVEYTENTYER |
| Ga0098058_11972082 | 3300006750 | Marine | MPEVGKKHYPYTTKGRAAAKMAAKKKGVKVGYGKRKKY* |
| Ga0098048_10044895 | 3300006752 | Marine | MPTVNGKKYAYTKTGMAAAKKAAKKTGKKVSYAKGKK* |
| Ga0098055_11084781 | 3300006793 | Marine | MPKVGKKHYSYTPKGMAKAKAAAKKSGKKISYAKKS |
| Ga0070749_100324361 | 3300006802 | Aqueous | MVGKKHYAYTAKGMAKAKAAAKKAGKPVKYGKKKKG* |
| Ga0070749_100532368 | 3300006802 | Aqueous | PKVGSKHYSYTPKGMAMAKAAAKKKGVKVQYGKKKSKK* |
| Ga0070749_100582004 | 3300006802 | Aqueous | MPKVNGKHYAYTKEGMAKAKAAAKKKGVKVQYGKKSNKKS* |
| Ga0070749_100660232 | 3300006802 | Aqueous | MPKVGSKHYSYSPEGIAMAKAAAKKKGVKVQYGNKKNKKNSK* |
| Ga0070749_101777914 | 3300006802 | Aqueous | MPKVGNKHYAYTPKGMAAAKKAAKKSGKKVSYRKKK* |
| Ga0070749_105452291 | 3300006802 | Aqueous | GLMPKVGSKHYSYTPKGMAMAKAAAKKKGMKVQYGKKKSKK* |
| Ga0075467_103460122 | 3300006803 | Aqueous | MPKVGSKHYAYTPKGMAKAKAAAKKSGKKVSYAKKK |
| Ga0070754_102307411 | 3300006810 | Aqueous | MPKVGSKHYSYTPKGMAMAKAAAKKKGMKVQYGKKKSKK* |
| Ga0075481_103544382 | 3300006868 | Aqueous | MPKVGKRHYSYTPKGIAQAKAAAKKKGVKVSYKKKKK* |
| Ga0075477_102671092 | 3300006869 | Aqueous | MPKVGSKHYSYTTKGMAMAKAAAKKKGMKVQYGKKKSKK* |
| Ga0070750_101745753 | 3300006916 | Aqueous | AQEVSKEEVGMPKVGNKHYAYTPKGMAAAKKAAKKSGKKVSYRKKK* |
| Ga0070750_102799592 | 3300006916 | Aqueous | MPMVNGKKYAYTAAGKKKAKAAAKKTGKKVSYGSRKK* |
| Ga0070746_100519222 | 3300006919 | Aqueous | MPRVGSKHYSYTPKGMAMAKAAAKKKGMKVQYGKKKSKK* |
| Ga0070746_100978012 | 3300006919 | Aqueous | MPKVGNKHYAYTPKGMAAAKKAAKKSGKKVNYRKKK* |
| Ga0070746_105452151 | 3300006919 | Aqueous | MPKVGKKEYPYTAKGMAMAKAKAKKTGQKVSYGKAKSK |
| Ga0070745_10788252 | 3300007344 | Aqueous | MPHKKGGGHMPKVGSKHYSYTPKGMAMAKAAAKKKGMKVQYGKKKSKK* |
| Ga0070745_12518732 | 3300007344 | Aqueous | MPKVGSKHYSYTPKGMAMAKAAAKKKGMKVQYGKKKSK |
| Ga0070752_12932241 | 3300007345 | Aqueous | GHMPKVGSKHYSYTPKGMAMAKAAAKKKGMKVQYGKKKSKK* |
| Ga0070753_11126662 | 3300007346 | Aqueous | MPKVGKKHYAYTKTGMAKAKAAAKKTGKKVSYAKKK* |
| Ga0070753_12120021 | 3300007346 | Aqueous | RGAMPHKKGGGLMPKVGSKHYSYTPKGMAMAKAAAKKKGMKVQYGKKKSKK* |
| Ga0099851_10330656 | 3300007538 | Aqueous | MPKVDGKEYPYTPKGMAMAKNKAKATGKKVTYGKKKKTK* |
| Ga0099851_11402253 | 3300007538 | Aqueous | MPKVGKKEYPYTAKGMAMAKAKAKKTGQKVSYGKAK |
| Ga0099851_13615132 | 3300007538 | Aqueous | MPKVGKRHYSYTPKGMAQAKAAAKKKGVKVLYKKKKK* |
| Ga0099849_100008014 | 3300007539 | Aqueous | MPNVNGKKYAYTPKGIAQAKAEAKKKGKKLKYNG* |
| Ga0099849_10316973 | 3300007539 | Aqueous | MPKVGTKHYPYTPKGMAMAKNAAKRKGLTVQYGKKK* |
| Ga0099849_10912252 | 3300007539 | Aqueous | MPKVGSKHYSYTPKGMAMAKAAAKKKGMKVQYGKPKGAKGRGKK* |
| Ga0099849_10933393 | 3300007539 | Aqueous | MPKVGKKEYPYTPKGMAMAKASAKRKGLKIKYGKK* |
| Ga0099847_10787512 | 3300007540 | Aqueous | MPKVAGKEYPYTPKGMAMAKNKAKATGKKVTYGKKKKAK* |
| Ga0099847_11287342 | 3300007540 | Aqueous | MPKVGSKHYAYTPKGIAMAKAAAKKKNTKVTYGSKKKKK* |
| Ga0099848_13460472 | 3300007541 | Aqueous | MPKVGSKHYSYSPEGIAMAKAAAKKKGVKVQYGNKKNK |
| Ga0099850_10094092 | 3300007960 | Aqueous | MPRVGKKEYPYTAKGMAMAKAAAKKKGTKVSYGKKKK* |
| Ga0110931_10453223 | 3300007963 | Marine | MAKVGDKRFPYTKKGMAKARAAAKKSGKKIIYAKKK* |
| Ga0114340_10772016 | 3300008107 | Freshwater, Plankton | MPKVGKKEYAYTPKGMAQAKADAKKKGMKVDYGKKKKGGK* |
| Ga0114340_11273723 | 3300008107 | Freshwater, Plankton | MPKVGKKEYAYTPKGMAQAKADAKKKGMKVSYGKSKKSK* |
| Ga0114899_10291343 | 3300008217 | Deep Ocean | MPKVGQRHYAYTPKGKAQAKASAKKMGVKVKYGTKKKG* |
| Ga0114899_10653782 | 3300008217 | Deep Ocean | MPKVGKKHYAYTNKGMARAKAAAKKLGKKVRYTKKK* |
| Ga0114876_10859783 | 3300008448 | Freshwater Lake | MPKVGNKEFAYNAKGMAMAKAEAKKAGKKMQTGSMSKGSVRKKKR |
| Ga0117920_11708203 | 3300009108 | Marine | VPKVGKRHYSYTPKGKAAAKAAAKRSGKKVTYAKKRK* |
| Ga0118687_1000003940 | 3300009124 | Sediment | MPKVGKKEYPYTPKGMAMAKASAKRKGLKIKYRG* |
| Ga0118687_100116956 | 3300009124 | Sediment | MPNVNGKKYSYTPKGIAMAKAAAKKKGKKIKYGK* |
| Ga0114918_100531714 | 3300009149 | Deep Subsurface | MPKVGTKKFPYTAKGKEAAKAAAKKSGKKVVKKY* |
| Ga0114996_107858761 | 3300009173 | Marine | MPKVGNKHYAYSAKGMAKAKSAAKKSGKKVSYAKSKRRT* |
| Ga0115563_11508533 | 3300009442 | Pelagic Marine | MPTVNGKKYAYTKTGMAAAKKAAKKSGKKVSYAKGKK* |
| Ga0115565_100543993 | 3300009467 | Pelagic Marine | MPIVNGKKYAYTKTGMAAAKKAAKKSGKKVSYAKGKK* |
| Ga0115011_113941373 | 3300009593 | Marine | MPKVGSKHYSYTAKGMAAAKAAAKKKGTKVQYKNK |
| Ga0115002_101568813 | 3300009706 | Marine | MPKVGNKHYSYSAKGMAKAKSAAKKSGKKVSYAKSKRRT* |
| Ga0115002_104348643 | 3300009706 | Marine | MPKVGKKHYSYTPKGMAKAKKAAKKMGVKVGYGKRKNC* |
| Ga0115002_104506962 | 3300009706 | Marine | MPKVGKKEYAYTAKGKAQAKTAAKRMGTKVKYGGKKKA* |
| Ga0098059_13840081 | 3300010153 | Marine | KHYSYTPKGMAMAKAAAKKKGVKVQYKKKSTRSK* |
| Ga0129348_10074777 | 3300010296 | Freshwater To Marine Saline Gradient | MPKVNGKEYSYTPKGIAMAKAAAKKKGKKVKYNRKQK* |
| Ga0129348_12734142 | 3300010296 | Freshwater To Marine Saline Gradient | MPKVGSKHYSYTPKGMAMAKASAKRKGLKIKYRG* |
| Ga0129345_12504472 | 3300010297 | Freshwater To Marine Saline Gradient | MPKVGSKHYSYTPKGMAMAKAAAKKKGVKVKYGKPKGAKGRGKK* |
| Ga0129342_11490642 | 3300010299 | Freshwater To Marine Saline Gradient | MPKVGSKHYSYSPKGIAMAKAAAKKKGMKVQYGKKKSKK* |
| Ga0129336_102136243 | 3300010370 | Freshwater To Marine Saline Gradient | MPKVGKKEYPYTPKGMAMAKAAAKKKGMKVQYGKKRGK* |
| Ga0136549_100053825 | 3300010389 | Marine Methane Seep Sediment | MPKVGNKKYAYTKAGMAKAKAAAKKSGKKIVQKKY* |
| Ga0118731_1060717001 | 3300010392 | Marine | MPKVAGKEYPYTKKGIAMAKNKAKAIGKKVTYNKKAKK* |
| Ga0133547_102278753 | 3300010883 | Marine | MPKVGKKHYSYTPKGKAAAKKAAKKMGVKVGYGKLKKR* |
| (restricted) Ga0172367_100013248 | 3300013126 | Freshwater | MPKVGKKEYPYTPKGMATAKNAAKKKGMKVTYGSKKGK* |
| Ga0180120_100562302 | 3300017697 | Freshwater To Marine Saline Gradient | MVGKKHYAYTAKGMAKAKAAAKAGKPVKYGKKKKG |
| Ga0180120_101205812 | 3300017697 | Freshwater To Marine Saline Gradient | MPKVGSKHYAYTPKGIAMAKAAAKKKNTKVTYGSKKKKK |
| Ga0181403_10032041 | 3300017710 | Seawater | MPMVNGKKYAYTTAGKKKAKAAAKKIGKKVSYGKGKK |
| Ga0181403_10048432 | 3300017710 | Seawater | MLEDITEVTMPKVGSKHYAYTPKGIAKAKAAAKKSGKKVSYAKKKE |
| Ga0181402_11607981 | 3300017743 | Seawater | MPKVGKKHYSYTPKGMAKAKAAAKKSGKKISYAKKSTR |
| Ga0181386_11861941 | 3300017773 | Seawater | MPKVGKKDYPYTAKGKMQAKQAAKRMGKKVSYGKKKG |
| Ga0181379_11716322 | 3300017783 | Seawater | MPMVNGKKYAYTTAGKKKAKAVAKKTGKKVSYGKGKK |
| Ga0169931_102690533 | 3300017788 | Freshwater | MPKVGKKEFAYTPKGMAQAKAAAKKTGMKVQYGKKKARGK |
| Ga0181565_105878921 | 3300017818 | Salt Marsh | VAQEVSKEEVGMPKVGNKHYAYTPKGMAAAKKAAKKSGKKVSYRKKK |
| Ga0181552_102734394 | 3300017824 | Salt Marsh | MPKVGKRHYSYTPKGMAQAKAAAKKKGVKVLYKKKKK |
| Ga0181552_104442292 | 3300017824 | Salt Marsh | MPKVGTKHYSYTPKGIAQAKAAAKKKGVKVSYKKKKK |
| Ga0181607_101599372 | 3300017950 | Salt Marsh | MPEVGKRHYSYTPKGIAQAKAAAKKKGVKVSYKKKKK |
| Ga0181577_1000140925 | 3300017951 | Salt Marsh | MPKVGNKHYAYTPKGMAAAKKAAKKSGKKVSYRKKK |
| Ga0181577_1000183218 | 3300017951 | Salt Marsh | MPKVGKKHYAYTKAGMAKAKAAAKKSGKKVSYAKKK |
| Ga0181577_101912142 | 3300017951 | Salt Marsh | MPKVAGKEYPYTKKGMAMAKAKAKATGKKVSYGKKSRTKK |
| Ga0181577_109048531 | 3300017951 | Salt Marsh | MPMVNGKKYAYTAAGKKKAKAAAKKTGKKVSYGSRKK |
| Ga0181583_108150122 | 3300017952 | Salt Marsh | MPKVGKKHYSYTPKGIAKAKAAAKKKGVKVSYKKK |
| Ga0181569_103735863 | 3300017986 | Salt Marsh | MPKVGKKHYAYTKAGMAKAKAAAKKSGKKLSYSKKK |
| Ga0181572_103656002 | 3300018049 | Salt Marsh | MPKVGKKEYPYTAKGMAMAKAKAKSTGKKVTYGKKSRTKK |
| Ga0181592_102644023 | 3300018421 | Salt Marsh | MPKVAGKHYPYTPKGIAMAKNKAKATGKKVQYGKKSRTKK |
| Ga0181591_107090781 | 3300018424 | Salt Marsh | MPKVGNKHYAYTPKGMAAAKKAAKKSGKKVNYRKKK |
| Ga0194016_10118212 | 3300019708 | Sediment | MPKVGKKHYAYTKAGMAKAKAAAKKTGKKVSYAKKK |
| Ga0194000_10013437 | 3300019750 | Sediment | MPKVGKKHYSYTKKGIAMAKAAAKKAGKKVSYKKK |
| Ga0194029_10033534 | 3300019751 | Freshwater | MPKVGSKHYAYTPKGMAKAKAAAKKSGKKVSYAKKAKK |
| Ga0194024_10040293 | 3300019765 | Freshwater | MPKVGKKEYPYTAKGMAMAKAAAKKKGTKVSYGRKKKK |
| Ga0194024_10731831 | 3300019765 | Freshwater | KVGSKHYAYTPKGMAKAKAAAKKSGKKVSYAKKAKK |
| Ga0211504_10631503 | 3300020347 | Marine | MPMVNGKKYAYTEAGKKKAKAAAKKTGRKVNYGKGKK |
| Ga0211514_102789691 | 3300020459 | Marine | MPKVGNKHYAYTAKGMAKAKAAAKKSGKKVSYGKSRRKA |
| Ga0211486_101918961 | 3300020460 | Marine | MPKVGNKHYAYTQKGMAKAKAAAKKSGKKVTYGKSSKRK |
| Ga0208465_100016023 | 3300020570 | Freshwater | MPKVGSKHYAYTPKGKAAAQKAAAQKGMKVQYASKARKRAK |
| Ga0213863_102869452 | 3300021371 | Seawater | MPTVNGKKYAYTKTGMAAAKKAAKKTGKKVSYAKGKK |
| Ga0213861_100067482 | 3300021378 | Seawater | MPKVDGKEYPYTPKGIAMAKNKAKATGKKVAYGKKKKTK |
| Ga0213864_100108647 | 3300021379 | Seawater | MPKVNGKEYSYTPKGIAMAKAAAKKKGKKVKYNRKQK |
| Ga0213866_100009269 | 3300021425 | Seawater | MPNVNGKKYSYTPKGIAKAKEAAKKKGKTLKARFKKDA |
| Ga0226832_100508273 | 3300021791 | Hydrothermal Vent Fluids | MPKVGNKHYSYTAKGMAKAKAAAKKSGKKVSYGKSRRKA |
| Ga0222717_101137882 | 3300021957 | Estuarine Water | MPKVGSKHYAYTPKGMAKAKVAAKKSGKKVSYAKKKK |
| Ga0222718_103510791 | 3300021958 | Estuarine Water | MPKVGSKHYAYTPKGMAKAKAAAKKSGKKVSYAKK |
| Ga0222718_103977713 | 3300021958 | Estuarine Water | MPMVNGKKYAYTAAGKKKAKAAAKKAGKKVSYAKS |
| Ga0222716_101712372 | 3300021959 | Estuarine Water | MEIMMPKVGSKHYAYTPKGVALATAAAKKSGKKVSYAKKKK |
| Ga0222716_105374601 | 3300021959 | Estuarine Water | VGKKHFAYTAKGMAKAKAAAKKAGKPVKHGKKKKG |
| Ga0222715_101416341 | 3300021960 | Estuarine Water | MEIMMPKVGSKHYAYTPKGMAQAQAIAKKSGKKVSYAKKKTKK |
| Ga0222715_102894553 | 3300021960 | Estuarine Water | MPMVNGKKYAYTTAGKKKAKAAAKKTGKKVSYGSRKK |
| Ga0222715_105222622 | 3300021960 | Estuarine Water | MPKVGSKHYAYTPKGVALATAAAKKSGKKVSYAKKAK |
| Ga0222714_100208317 | 3300021961 | Estuarine Water | MPKVGNKKYAYTKAGMAKAKAAAKKSGKKIVKKKS |
| Ga0222719_102008031 | 3300021964 | Estuarine Water | MPKVNGKHYAYTKQGMAKAKAAAKKKGVKVKYGKKKS |
| Ga0196883_10063753 | 3300022050 | Aqueous | MPKVGKKHYAYTKAGMAKAKAAAKKSGKKVMYAKKK |
| Ga0196883_10068822 | 3300022050 | Aqueous | MPKVGKKEYPYTAKGMAMAKAAAKKKGTKVSYGKKKK |
| Ga0196895_10177502 | 3300022067 | Aqueous | TMPKVGKKEYPYTAKGMAMAKAAAKKKGTKVSYGRKKKK |
| Ga0212021_10487102 | 3300022068 | Aqueous | MPKVGKKEYPYTAKGMAMAKAAAKKKGTKVSYGGKKKK |
| Ga0196905_10010519 | 3300022198 | Aqueous | MPKVDGKEYPYTPKGMAMAKNKAKATGKKVTYGKKKKTK |
| Ga0224504_102215473 | 3300022308 | Sediment | MEIMMPKVGSKHYAYTPKGMAKAKAAAKKSGKKVSYAKKAKK |
| Ga0255765_11726063 | 3300022921 | Salt Marsh | MPKVGKRHYSYTPKGIAQAKAAAKKKGVKVSYKKKKK |
| Ga0255751_104058934 | 3300023116 | Salt Marsh | KVGAKKFAYTKAGKAKAKAYAKKTGKKLSYGKGKK |
| Ga0255777_106478912 | 3300023175 | Salt Marsh | GIMPKVGKKHYAYTKAGMAKAKAAAKKSGKKVSYAKKK |
| Ga0228635_10305734 | 3300024328 | Seawater | MPKVGSKHYAYTPKGMAQAQAIAKKSGKKVSYAKKKTKK |
| (restricted) Ga0255048_1000801412 | 3300024518 | Seawater | MPKVGKKHYSYTPKGMAKAKKAAKKMGVKVGYGKRKNC |
| Ga0208791_10314572 | 3300025083 | Marine | MPKVGKKHYSYTPKGMAKAKAAAKKSGKKISYAKKST |
| Ga0209349_10117243 | 3300025112 | Marine | MPEVGKKHYPYTTKGRAAAKMAAKKKGVKVGYGKRKK |
| Ga0208919_10803482 | 3300025128 | Marine | MAKVGDKRFPYTKKGMAKARAAAKKSGKKIIYAKKK |
| Ga0209232_10718175 | 3300025132 | Marine | PKVDGKSYSYTPKGMAMAKAAAKKKGKKIKYNGKTMRKG |
| Ga0209645_10791142 | 3300025151 | Marine | MPKVKGKHYDYTPKGIAMAKNAAKREGVKVKYKKS |
| Ga0209337_10435955 | 3300025168 | Marine | MPKVGKRSFSYTKAGMAKAKKAAKQSGKSLMKAVKKK |
| Ga0208029_10307682 | 3300025264 | Deep Ocean | MPKVGNKHYSYSPKGIAKAKAAAKKKGVKVQYKKK |
| Ga0208450_10862563 | 3300025301 | Deep Ocean | MPKVGKKHYPYTHAGRRAAKEAAKKKGLKVEYTENT |
| Ga0208303_10738422 | 3300025543 | Aqueous | MPKVAGKEYPYTPKGMAMAKNKAKATGKKVTYGKKKKAK |
| Ga0208149_10037935 | 3300025610 | Aqueous | MPKVGKRHYSYTPKGMAQAKAAAKKKGVKVSYKKTKK |
| Ga0209198_11389673 | 3300025640 | Pelagic Marine | MPTVNGKKYAYTKTGMAAAKKAAKKSGKKVSYAKGKK |
| Ga0208161_11159062 | 3300025646 | Aqueous | VGKKEYPYTAKGMAMAKAAAKKKGTKVSYGRKKKK |
| Ga0208898_11475822 | 3300025671 | Aqueous | MPHKKGGGHMPKVGSKHYSYTPKGMAMAKAAAKKKGMKVQYGKKKSKK |
| Ga0208162_10989712 | 3300025674 | Aqueous | MPKVGSKHYSYTPKGMAMAKAAAKKKGMKVQYGKPKGAKGRGKK |
| Ga0208150_10449445 | 3300025751 | Aqueous | MPKVGKKHYSYTPKGMAQAKAAAKKKGVKVSYKKKK |
| Ga0208767_10992441 | 3300025769 | Aqueous | MPKVGKKEYPYTAKGMAMAKAKAKKTGQKVSYGKTKSK |
| Ga0208767_12783781 | 3300025769 | Aqueous | MPKVGKKEYPYTAKGMAMAKAKAKKTGQKVSYGKAKSKSK |
| Ga0208542_10768513 | 3300025818 | Aqueous | MPKVNGKHYAYTKEGMAKAKAAAKKKGVKVQYGKKSNKKS |
| Ga0208644_13453932 | 3300025889 | Aqueous | VLCPIKKGGGLMPRVGSKHYSYTPKGMAMAKAAAKKKGMKVQYGKKKSKK |
| Ga0209972_101587983 | 3300027793 | Freshwater Lake | MPKVGKKEYAYTPKGMAQAKADAKKKGMKVQYGKSKKGGK |
| Ga0209403_100841051 | 3300027839 | Marine | MPKVGNKHYAYSAKGMAKAKSAAKKSGKKVSYAKSKRRT |
| Ga0209402_100437934 | 3300027847 | Marine | MPKVGKKHYSYTPKGKAAAKKAAKKMGVKVGYGKRKKY |
| Ga0209404_107653542 | 3300027906 | Marine | MPKVGSKHYSYTPKGMAKAKAAAKKKGVKVQYKGKKK |
| Ga0209536_1001065784 | 3300027917 | Marine Sediment | MPRVGKKEYPYTAKGMAMAKAAAKKKGTKVSYGKKKK |
| Ga0256382_10054513 | 3300028022 | Seawater | MPKVGQRHYAYTPKGKAQAKAAAKKMGVKVKYGTKKKG |
| Ga0256382_10208964 | 3300028022 | Seawater | MPKVGNKHYAYTAKGMAKAKAAAKKSGKKVSYGKSKRRT |
| Ga0307379_104058882 | 3300031565 | Soil | MPKVGTKHYPYTPKGMAMAKNTAKRKGLTVQYGKKK |
| Ga0302132_100045067 | 3300031605 | Marine | MPKVGNKHYSYSAKGMAKAKSAAKKSGKKVSYAKSKRRT |
| Ga0302132_101689881 | 3300031605 | Marine | MPKVGNKHYAYSAKGMAKAKSAAKKSGKKVSYSKSKRRT |
| Ga0315900_100528263 | 3300031787 | Freshwater | MPKVGKKEYAYTPKGMAQAKADAKKKGMKVDYGKKKKGGK |
| Ga0310123_106664682 | 3300031802 | Marine | VPKVGSKHYPYSKKGTAQAKADAKKRGMAVSYGKKKSEKKGR |
| Ga0315318_103677931 | 3300031886 | Seawater | MPRVGKKHYAYTAKGMAKAKAAAKKSGKKVIYAKSKRRT |
| Ga0335031_0000336_26031_26162 | 3300034104 | Freshwater | MPKVGKKEYPYTPKGMAMAKNAAKKQGVKVKYGKSKKASKGGK |
| Ga0335063_0218188_148_273 | 3300034111 | Freshwater | MPKVGKKEYPYTPKGMAMAKAEAKKTGMKMKTGKKAKGRGK |
| Ga0335065_0149038_615_731 | 3300034200 | Freshwater | MPKVGKKEYAYTPKGMAMAKAAAKKKGVKVQYGKKRGK |
| Ga0348335_100173_721_840 | 3300034374 | Aqueous | MPKVGSKHYSYTPKGMAMAKAAAKKKGVKVQYGKKKSKK |
| Ga0348335_139965_98_217 | 3300034374 | Aqueous | MPKVGSKHYSYTPKGMAMAKAAAKKKGMKVQYGKKKSKK |
| ⦗Top⦘ |