| Basic Information | |
|---|---|
| Taxon OID | 3300007354 Open in IMG/M |
| Scaffold ID | Ga0104761_1066418 Open in IMG/M |
| Source Dataset Name | Deep subsurface aquifer microbial community from Lead, South Dakota (SURF_DUSEL_B) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Aeronautics and Space Administration (NASA) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 807 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → unclassified Peptococcaceae → Peptococcaceae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Aquifer → Sanford Underground Research Facility - Surf_Dusel_B |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lead, South Dakota, USA | |||||||
| Coordinates | Lat. (o) | -44.0341666 | Long. (o) | -103.765833 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021446 | Metagenome / Metatranscriptome | 219 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0104761_10664182 | F021446 | AGGAGG | MKTLSIALMAAFMLVLAATSTGQAQNAEYRDLDPTVGGKYIYRGADYIAQTLIVRGDKLSEINELTLIIQIKGSPDFRVTFPLLAKRQEGNKLILDYQWYPGGDTYEATIIGGTLINRKTKGYLAGIREELFIRE* |
| ⦗Top⦘ |