3300007354: Deep subsurface aquifer microbial community from Lead, South Dakota (SURF_DUSEL_B)

Overview

Basic Information

• IMG/M Taxon OID: 3300007354
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0114815 | Gp0115815 | Ga0104761
• Sample Name: Deep subsurface aquifer microbial community from Lead, South Dakota (SURF_DUSEL_B)
• Sequencing Status: Permanent Draft
• Sequencing Center: National Aeronautics and Space Administration (NASA)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 279823141
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → unclassified Peptococcaceae → Peptococcaceae bacterium	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Sanford Underground Research Facility - Surf_Dusel_B
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Aquifer → Sanford Underground Research Facility - Surf_Dusel_B

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): aquatic biome → aquifer → groundwater
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: Lead, South Dakota, USA
• Coordinates
  • Lat. (^o): -44.0341666
  • Long. (^o): -103.765833
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021446	Metagenome / Metatranscriptome	219	Y
F082184	Metagenome	113	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0104761_1013263	All Organisms → cellular organisms → Bacteria	2190
Ga0104761_1066418	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → unclassified Peptococcaceae → Peptococcaceae bacterium	807

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0104761_1013263	Ga0104761_10132633	F082184	VDRKQAEAYAIHMLKFIRQEWPAAKPVSLEVGRDDKSEVLWCKIHRNEEDLTHGSGHLFTVAYLDREIVA*
Ga0104761_1066418	Ga0104761_10664182	F021446	MKTLSIALMAAFMLVLAATSTGQAQNAEYRDLDPTVGGKYIYRGADYIAQTLIVRGDKLSEINELTLIIQIKGSPDFRVTFPLLAKRQEGNKLILDYQWYPGGDTYEATIIGGTLINRKTKGYLAGIREELFIRE*