Scaffold Ga0104761_1013263

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0104761_1013263

Scaffold Ga0104761_1013263

Overview

Basic Information
Taxon OID	3300007354 Open in IMG/M
Scaffold ID	Ga0104761_1013263 Open in IMG/M
Source Dataset Name	Deep subsurface aquifer microbial community from Lead, South Dakota (SURF_DUSEL_B)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	National Aeronautics and Space Administration (NASA)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2190
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Aquifer → Sanford Underground Research Facility - Surf_Dusel_B

Source Dataset Sampling Location
Location Name	Lead, South Dakota, USA
Coordinates	Lat. (^o)	-44.0341666	Long. (^o)	-103.765833	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082184	Metagenome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0104761_10132633	F082184	AGGAG	VDRKQAEAYAIHMLKFIRQEWPAAKPVSLEVGRDDKSEVLWCKIHRNEEDLTHGSGHLFTVAYLDREIVA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.