NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0104340_100053

Scaffold Ga0104340_100053


Overview

Basic Information
Taxon OID3300007347 Open in IMG/M
Scaffold IDGa0104340_100053 Open in IMG/M
Source Dataset NameHuman supragingival plaque microbial communities from NIH, USA - visit 1, subject 764649650 reassembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)59808
Total Scaffold Genes58 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (10.34%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F080165Metagenome115N
F090516Metagenome108N

Sequences

Protein IDFamilyRBSSequence
Ga0104340_10005327F090516N/AMKSNLSVELFLAFERYFIENDEVISLDKSLEFTDVIVGIGFLPHDMSENTDFKKKTLEKYGFSSSTALADDFRKRVLNIDEPIPENFEKDGIGYVYTVISGYDTFYNRMYMFGIHCFNGDFNVTYFDLDNDAGTGDYYEEHELYSQAKGYRWLDPESDYYEDVLAWEALNKLATDIYFHLEDRLDVKIDIKPIPEEEKVEPTQEHLAKFLAFCGVEQEVIDENKERLLKALEEYTPDEYEGVSEAMAEMMEYSHKIQRAEPVIEIIREYGVCRSSDWKFYAEELEEYILDLADFSDWKWEYPADIYSADLFPYMRKQLSLYHLWLCHLDEGADAYLFLLFSEKDMPEIMKLARRILDLPLKAYFK*
Ga0104340_1000533F080165N/AMKNKKFLLAILLSLTACNNKTKTISTLDLEKTIIDYKDLPSKVKERVFYGEAMKLGEEDEERFQDFQETNNPKKYEYYTKQDPQLAWVHYPYIRNKKTKQEYSIDKDGPMGGRYIIYGDSLYISNHYNIYEEDSLSYTFTRYILR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.