Scaffold Ga0079920_1090482

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0079920_1090482

Scaffold Ga0079920_1090482

Overview

Basic Information
Taxon OID	3300007301 Open in IMG/M
Scaffold ID	Ga0079920_1090482 Open in IMG/M
Source Dataset Name	Hydrothermal vent microbial communities from Teddy Bear hydrothermal vent, East Pacific Rise - large volume pump, sample 5
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Bigelow Laboratory Single Cell Genomics Center (SCGC)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	537
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Fluid → Hydrothermal Vent Microbial Communities From Teddy Bear Hydrothermal Vent, East Pacific Rise

Source Dataset Sampling Location
Location Name	Teddy Bear Hydrothermal Vent, East Pacific Rise
Coordinates	Lat. (^o)	9.847222	Long. (^o)	-104.2975	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055187	Metagenome / Metatranscriptome	139	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0079920_10904821	F055187	N/A	MRVVNGNVIKSPADLVGLKPFKDAKLLRHEAIERMKRHMERKLKQSKEEARLAQPYVRDADAPSF

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.