| Basic Information | |
|---|---|
| Taxon OID | 3300007301 Open in IMG/M |
| Scaffold ID | Ga0079920_1057799 Open in IMG/M |
| Source Dataset Name | Hydrothermal vent microbial communities from Teddy Bear hydrothermal vent, East Pacific Rise - large volume pump, sample 5 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Bigelow Laboratory Single Cell Genomics Center (SCGC) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 622 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED264 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Fluid → Hydrothermal Vent Microbial Communities From Teddy Bear Hydrothermal Vent, East Pacific Rise |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Teddy Bear Hydrothermal Vent, East Pacific Rise | |||||||
| Coordinates | Lat. (o) | 9.847222 | Long. (o) | -104.2975 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F061282 | Metagenome / Metatranscriptome | 132 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0079920_10577992 | F061282 | N/A | VLYEDSPTTAMGGGNIAVRGIPLLKKPPKGLVMKRFGGIDVFAIDPTYFQKSRLGKKKYTRYSGYVGEDEAGEYIRAFARKYPKKPIIVMDSQTGCMQYLRHGS* |
| ⦗Top⦘ |