Scaffold Ga0079920_1040097

Overview

Basic Information

• Taxon OID: 3300007301
• Scaffold ID: Ga0079920_1040097
• Source Dataset Name: Hydrothermal vent microbial communities from Teddy Bear hydrothermal vent, East Pacific Rise - large volume pump, sample 5
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Bigelow Laboratory Single Cell Genomics Center (SCGC)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 702
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Fluid → Hydrothermal Vent Microbial Communities From Teddy Bear Hydrothermal Vent, East Pacific Rise

Source Dataset Sampling Location

• Location Name: Teddy Bear Hydrothermal Vent, East Pacific Rise
• Coordinates
  • Lat. (^o): 9.847222
  • Long. (^o): -104.2975

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033215	Metagenome / Metatranscriptome	178	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0079920_10400971	F033215	N/A	TVLERDALSVNETLVLVMVQVSATAKLPPRLRVVFEVLNKAPLANVAPIGRLRVPPVEERVPAVALIPPLRDKLALPVTIFSPAASRVTGCATLRLDILSSSVKAKLARSSVPTDREALSSIVEFAAKRRVVELSGNTPPKFCVPDTSRMPPESVSALAFVVNVVFFVLRVAPVSDKAFCSTNVVSGSEILVPDGALAPETRVIVPPEEFSDALSVNANAPERVRLPAPVSRA