Basic Information | |
---|---|
Taxon OID | 3300007301 Open in IMG/M |
Scaffold ID | Ga0079920_1009239 Open in IMG/M |
Source Dataset Name | Hydrothermal vent microbial communities from Teddy Bear hydrothermal vent, East Pacific Rise - large volume pump, sample 5 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Bigelow Laboratory Single Cell Genomics Center (SCGC) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1113 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Fluid → Hydrothermal Vent Microbial Communities From Teddy Bear Hydrothermal Vent, East Pacific Rise |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Teddy Bear Hydrothermal Vent, East Pacific Rise | |||||||
Coordinates | Lat. (o) | 9.847222 | Long. (o) | -104.2975 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F002348 | Metagenome / Metatranscriptome | 568 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0079920_10092393 | F002348 | GGA | MKPNEKWMKYGGWLLSLLSILIGASFLWPHVHVALLGIAFIYLGIRIFNFSTFDEYKEKRMKLLYKLLK* |
⦗Top⦘ |