Scaffold Ga0102636_102095

Overview

Basic Information

• Taxon OID: 3300007285
• Scaffold ID: Ga0102636_102095
• Source Dataset Name: Human attached/keratinized gingiva microbial communities from NIH, USA - visit 1, subject 763496533
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4332
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Capnocytophaga (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Oral Cavity → Attached/Keratinized Gingiva → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location

• Location Name: USA: Maryland: Natonal Institute of Health
• Coordinates
  • Lat. (^o): 39.0042816
  • Long. (^o): -77.1012173

Associated Families

Family	Category	Number of Sequences	3D Structure?
F097525	Metagenome	104	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0102636_1020957	F097525	N/A	MQQKKIMFKIQNAYQKIIFSIHGHRDRKENFEDWLKVEVKVKDDLEGKYYTRVSECMLFSEVLGLLEWFEQISADKEKSTEIDFIEPELAFEYQNKKLTVLLCYDIAPVSYGEEPYQLTFPLDDKTLAMIIKELGEAVASFKKV*