| Basic Information | |
|---|---|
| Taxon OID | 3300007218 Open in IMG/M |
| Scaffold ID | Ga0103964_1055831 Open in IMG/M |
| Source Dataset Name | Pinova apple microbial communities from Italy |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Illumina |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 8464 |
| Total Scaffold Genes | 14 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (35.71%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Pleosporineae → Pleosporaceae → Alternaria → Alternaria sect. Alternaria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Phyllosphere → Carposphere → Unclassified → Fruit → Insights Gained From Metagenomic Shotgun Sequencing Of Apple Fruit Epiphytic Microbiota |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Italy | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F102612 | Metagenome / Metatranscriptome | 101 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103964_10558316 | F102612 | N/A | MSSPAQPSPQVLQAYHQRLETLYSSLPDLLTTEQEDKTGTEALEQDVGKLDVKEQNLEDRVNKYCQEFLYIGGPTPYKRDLTST* |
| ⦗Top⦘ |