Basic Information | |
---|---|
Taxon OID | 3300007115 Open in IMG/M |
Scaffold ID | Ga0101551_1041471 Open in IMG/M |
Source Dataset Name | Marine sponge Stylissa sp. microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble', st44is |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of New South Wales |
Sequencing Status | Finished |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 886 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Sponge (Stylissa Sp.) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Upa-Upasina (low pH), Papua New Guinea | |||||||
Coordinates | Lat. (o) | -9.8241 | Long. (o) | 150.825833 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F020710 | Metagenome / Metatranscriptome | 222 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0101551_10414712 | F020710 | N/A | VTATIARADAADSMMFKVTSDTTFKIFNMDAITDTTANGDGVFISDTASDEGKAAYIVSRVNYLRPAKAVGWNDIQGFIDFASQIGGGDA* |
⦗Top⦘ |