Scaffold Ga0102629_123998

Overview

Basic Information

• Taxon OID: 3300007104
• Scaffold ID: Ga0102629_123998
• Source Dataset Name: Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 765034022
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 725
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location

• Location Name: USA: Maryland: Natonal Institute of Health
• Coordinates
  • Lat. (^o): 39.0042816
  • Long. (^o): -77.1012173

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043991	Metagenome	155	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0102629_1239982	F043991	GAG	MSKKNPSVIDYFDLNGDLNEEAYEFEDVKLDEYIDKRSNVKPSWIGKYSHQMHFDLPDDTEVSFYKGLNIVYADINFAGGIRTILFKCRQKKNLTRFISRVLEIAQGDPSNVHPDFRA*