Scaffold Ga0101646_1010695

Overview

Basic Information

• Taxon OID: 3300007069
• Scaffold ID: Ga0101646_1010695
• Source Dataset Name: Marine sponge Cinachyra sp. microbiome, Papua New Guinea CO2seep, Dobu 'bubble', cg4ads
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of New South Wales
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 945
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Cinachyra Sp. (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location

• Location Name: Dobu 'bubble' site, Papua New Guinea
• Coordinates
  • Lat. (^o): -9.73665
  • Long. (^o): 150.867667

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067211	Metagenome / Metatranscriptome	126	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0101646_10106951	F067211	N/A	MSFLEPVIASLLGAAVTALAVFLKKNMTAVALLKYGPLVQKAYDIIDPVLDKNLSNWDGSKVDRAFELAVESVADGELSSAEIKKLAVHMAQSWLPGAAAEKVRLLEQNGMPLEQRKAAEDITAKVNTAS*