Basic Information | |
---|---|
Taxon OID | 3300007069 Open in IMG/M |
Scaffold ID | Ga0101646_1007691 Open in IMG/M |
Source Dataset Name | Marine sponge Cinachyra sp. microbiome, Papua New Guinea CO2seep, Dobu 'bubble', cg4ads |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of New South Wales |
Sequencing Status | Finished |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1104 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Cinachyra Sp. (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Dobu 'bubble' site, Papua New Guinea | |||||||
Coordinates | Lat. (o) | -9.73665 | Long. (o) | 150.867667 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F015565 | Metagenome / Metatranscriptome | 253 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0101646_10076911 | F015565 | N/A | MLLFCAKTVVKESREFEPARLKKKEKHFGRLATFWFGTFAMLFSATGCVHSKMNGRVL* |
⦗Top⦘ |