Scaffold Ga0101640_1037664

Overview

Basic Information

• Taxon OID: 3300007060
• Scaffold ID: Ga0101640_1037664
• Source Dataset Name: Marine sponge Cinachyra sp. associated microbial community from CO2 seep in Upa-Upasina, Papua New Guinea - cg24is
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of New South Wales
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 566
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Cinachyra Sp. (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location

• Location Name: Upa-Upasina 'bubble' site, Papua New Guinea
• Coordinates
  • Lat. (^o): -9.8241
  • Long. (^o): 150.825833

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034602	Metagenome	174	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0101640_10376643	F034602	N/A	YDVGMTNRFKEILPPHTKEEKSYPQLISLGIMLLGILIIDIMGYYHGNMTLLEVLKNL*