Scaffold Ga0079218_10025893

Overview

Basic Information

• Taxon OID: 3300007004
• Scaffold ID: Ga0079218_10025893
• Source Dataset Name: Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3304
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (14.29%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → unclassified Thaumarchaeota → Thaumarchaeota archaeon (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil → Agricultural Soil Microbial Communities From Utah And Georgia To Study Nitrogen Management

Source Dataset Sampling Location

• Location Name: USA: Utah
• Coordinates
  • Lat. (^o): 41.7655
  • Long. (^o): -111.8143

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077757	Metagenome / Metatranscriptome	117	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0079218_100258934	F077757	N/A	MNKNYHFSIISSILVILVLSFFSLIATYSQNSEISVIVNLINGDKFIGQTWDINAQLKDKSSNSEISKDQTTFKVNQNQTIQMILPLSNATQDLNRYSIFVDSSSTIDDVDVFGTIDSLTNNDNRITLNLTNAR*