Scaffold Ga0101660_101016

Overview

Basic Information

• Taxon OID: 3300006958
• Scaffold ID: Ga0101660_101016
• Source Dataset Name: Marine sponge C. singaporensis. microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble', co31is
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of New South Wales
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 1231
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Coelocarteria Singaporensis (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location

• Location Name: Upa-Upasina
• Coordinates
  • Lat. (^o): -9.8241
  • Long. (^o): 150.825833

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017657	Metagenome	239	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0101660_1010163	F017657	GGAGG	MMMMDNNRKEALDKATKAKQKMAVEAEMMKQIQPTVPEVTAENIDMQPAIIPKPKPEGPVVGANVFNPGKLYPGISGTSKLAANWN