Scaffold Ga0081247_1198004

Overview

Basic Information

• Taxon OID: 3300006933
• Scaffold ID: Ga0081247_1198004
• Source Dataset Name: Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A100I (Metagenome Metatranscriptome) (version 2)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1143
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil → Tropical Rainforest Soil Microbial Communities From The Amazon Forest, Brazil, For Analyzing Deforestation At Different Spatial Scales

Source Dataset Sampling Location

• Location Name: Amazon Forest, Brazil
• Coordinates
  • Lat. (^o): -10.0
  • Long. (^o): -62.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077054	Metagenome / Metatranscriptome	117	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0081247_11980041	F077054	AGGAG	MYEHLERLFQGLAPASEYLKGVYYELAEEFFKQLRQQIEVTQNELRESEQLELYYHTQGEEPMLVSKIGYLAPGLLVLYGTDGRNNDCKVLAHL