| Basic Information | |
|---|---|
| Taxon OID | 3300006886 Open in IMG/M |
| Scaffold ID | Ga0102494_104429 Open in IMG/M |
| Source Dataset Name | T0 (3) T65 (live) enrichments of Methanogenic microbial communities using Athabascan oil sands |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Shell Corporation |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2209 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Epsilonproteobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Oil Sands → Methanogenic Incubations Using Athabaskan Oil Sands From Alberta Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Alberta, Canada | |||||||
| Coordinates | Lat. (o) | 57.02 | Long. (o) | -111.65 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F102132 | Metagenome | 102 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0102494_1044292 | F102132 | GGAG | MSTRKVIKNLEAAIDRICEDIKDKKTGSGSDKLDSLAKLVNSYGRLIERKKEKAYDKMMDGDPKQYKRMLKAGNKDMKGIIR* |
| ⦗Top⦘ |