Scaffold Ga0031675_1274248

Overview

Basic Information

• Taxon OID: 3300006720
• Scaffold ID: Ga0031675_1274248
• Source Dataset Name: Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP2618 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 546
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: Northeast of Antigua and Barbuda, North Atlantic Ocean
• Coordinates
  • Lat. (^o): 19.99
  • Long. (^o): -52.64

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010768	Metagenome / Metatranscriptome	299	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0031675_12742482	F010768	AGG	MPDINSPQITNAILEGARTMCEVLRGGYIVHPDPPPNSVITERIRSIYERNKINIEKLFILG