NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0005504_1296239

Scaffold Ga0005504_1296239


Overview

Basic Information
Taxon OID3300006718 Open in IMG/M
Scaffold IDGa0005504_1296239 Open in IMG/M
Source Dataset NameMarine microbial communities from the Deep Atlantic Ocean - MP0747 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)521
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas cichorii(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameAtlantic Ocean
CoordinatesLat. (o)-32.4846Long. (o)12.4609Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030551Metagenome / Metatranscriptome185Y

Sequences

Protein IDFamilyRBSSequence
Ga0005504_12962391F030551N/ANNGGKRMKNSIRNLIITAALVTGMFGIVNAQTEVSGEFSSDVTVGDATAFSTPYTGLSISGDGWELSTNLSDGDVIVEEAKYNFAISDAITATFGSQAEPYGIAWGSHRPSGNSFVSAPRDHSISTGVGVSTSAYGVGANAFYGDDNYWAARASYDVSAFGINSTIGLSVNSD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.