Basic Information | |
---|---|
Taxon OID | 3300006718 Open in IMG/M |
Scaffold ID | Ga0005504_1296239 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the Deep Atlantic Ocean - MP0747 (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 521 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas cichorii | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Atlantic Ocean | |||||||
Coordinates | Lat. (o) | -32.4846 | Long. (o) | 12.4609 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F030551 | Metagenome / Metatranscriptome | 185 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0005504_12962391 | F030551 | N/A | NNGGKRMKNSIRNLIITAALVTGMFGIVNAQTEVSGEFSSDVTVGDATAFSTPYTGLSISGDGWELSTNLSDGDVIVEEAKYNFAISDAITATFGSQAEPYGIAWGSHRPSGNSFVSAPRDHSISTGVGVSTSAYGVGANAFYGDDNYWAARASYDVSAFGINSTIGLSVNSD |
⦗Top⦘ |