Scaffold Ga0005504_1280968

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0005504_1280968

Scaffold Ga0005504_1280968

Overview

Basic Information
Taxon OID	3300006718 Open in IMG/M
Scaffold ID	Ga0005504_1280968 Open in IMG/M
Source Dataset Name	Marine microbial communities from the Deep Atlantic Ocean - MP0747 (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	544
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location Name	Atlantic Ocean
Coordinates	Lat. (^o)	-32.4846	Long. (^o)	12.4609	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066848	Metagenome / Metatranscriptome	126	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0005504_12809682	F066848	AGGA	MRFSTRSIHSLRHPQDDVYRAVSTEVGPGFAMGSSDSVLRTVLAGARQIAADQRLPVDPVAKGAGSEPELDLVA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.