Scaffold Ga0005504_1042471

Overview

Basic Information

• Taxon OID: 3300006718
• Scaffold ID: Ga0005504_1042471
• Source Dataset Name: Marine microbial communities from the Deep Atlantic Ocean - MP0747 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 626
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: Atlantic Ocean
• Coordinates
  • Lat. (^o): -32.4846
  • Long. (^o): 12.4609

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025846	Metagenome / Metatranscriptome	200	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0005504_10424712	F025846	AGTAGG	MVNLTVAMDLVSMAHGHVTAMVTVPMAQMKPIVLLHHVKTRVSGIVVMESAYQHPMYVMAQVNFVTQAGLLTVLMAQMKA*