| Basic Information | |
|---|---|
| Taxon OID | 3300006717 Open in IMG/M |
| Scaffold ID | Ga0031665_1025976 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP0548 (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 526 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | South Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | -26.95 | Long. (o) | -21.4 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F090441 | Metatranscriptome | 108 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0031665_10259761 | F090441 | N/A | ATLSFPDSLALGALITRRVIVGCQFPDAVSYRKNDFDTFRSHSGT* |
| ⦗Top⦘ |