Scaffold Ga0031696_1190348

Overview

Basic Information

• Taxon OID: 3300006699
• Scaffold ID: Ga0031696_1190348
• Source Dataset Name: Metatranscriptome of deep ocean microbial communities from Pacific Ocean - MP2156 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 563
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Pirellula → Pirellula staleyi (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: Southwest of Acapulco, Mexico, North Pacific Ocean
• Coordinates
  • Lat. (^o): 12.0
  • Long. (^o): -108.08

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087070	Metatranscriptome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0031696_11903481	F087070	N/A	DTQNDCGKKALGISGIDHDKFTQCVQDGLSISAGCSECYYTVADYGFKNCKAACLLGWCKSGCLSCTQPAQDGLPGCTGFSPAVAEPCLETEVTGACGADDQAALADAKTVGEKQDACGKKALGLSGIDHDKFTSCIQSDLGISSGCSECYYTVADYGFKNCKAACLLGWCKSGCLSCTQPAQDGLP