Scaffold Ga0031674_1159146

Overview

Basic Information

• Taxon OID: 3300006696
• Scaffold ID: Ga0031674_1159146
• Source Dataset Name: Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP2498 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 924
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: East of Antigua and Barbuda, Atlantic Ocean
• Coordinates
  • Lat. (^o): 17.43
  • Long. (^o): -59.83

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037232	Metagenome / Metatranscriptome	168	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0031674_11591461	F037232	N/A	ASIRPPSSLVTMTAFKIYDLVNTVYGTGYVANIRSDCYVVLLTHWKLAQGQSPTLYLQADSMSLIPGALPGTVVSTPFGPAHLKSVRADNMHIAKPLNWKLANDTVATMYLQPEVVKVTQTPGFNEGDEVMTVYGQGYIKAKRENKGDLVVLLRNWALAQGQSPTCYLQPSACVKIPGLEIGAAVKTVWGLMRLLSIRRDGTHVCEAMHWNLADGKPPRCYLAPEAFALMSIKP*