Basic Information | |
---|---|
Taxon OID | 3300006688 Open in IMG/M |
Scaffold ID | Ga0031687_1091912 Open in IMG/M |
Source Dataset Name | Metatranscriptome of deep ocean microbial communities from South Indian Ocean - MP1089 (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 594 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Magnaporthales → Pyriculariaceae → Pyricularia → Pyricularia oryzae | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | South Indian Ocean | |||||||
Coordinates | Lat. (o) | -29.81 | Long. (o) | 82.62 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F061786 | Metagenome / Metatranscriptome | 131 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0031687_10919121 | F061786 | N/A | YLCETIYPPEDGRSCIPPEKLEKAIKKGEIPPPSQDDEEDLDGNMDEVIDGCIREVWAYYDPKGAGALNKKQTQQFFKDALNLVALRKQCKVKDLFQGRNQSSALDAAFKKVNTSGDGRVTFEQFEEFINMCELDEAISFLTGADGEVQIDTTRVEMVDTSAIPSGGGPVKGKIEYRDYSALE* |
⦗Top⦘ |