| Basic Information | |
|---|---|
| Taxon OID | 3300006675 Open in IMG/M |
| Scaffold ID | Ga0081196_1000028 Open in IMG/M |
| Source Dataset Name | Microbial communities of Palythoa variabilis from marine subtidal rocky reef in Praia da Pedra Rachada, Paracuru, CE, Brazil |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | UNIVERSIDADE DE SAO PAULO |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 622 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Invertebrates → Cnidaria → Unclassified → Unclassified → Marine Subtidal Rocky Reef → Zoanthid-Associated Microbial Communities From Different Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Praia da Pedra Rachada, Paracuru, CE, Brazil | |||||||
| Coordinates | Lat. (o) | -3.398594 | Long. (o) | -39.014155 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007917 | Metagenome / Metatranscriptome | 342 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0081196_10000282 | F007917 | N/A | MSKDGIVCLLMILNVNTYANVILERSLRANEGHIGVNESIMTVMKQIWTQMNVYFP* |
| ⦗Top⦘ |