x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300006675
3300006675: Microbial communities of Palythoa variabilis from marine subtidal rocky reef in Praia da Pedra Rachada, Paracuru, CE, Brazil
Overview
| Basic Information |
| IMG/M Taxon OID | 3300006675 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0116711 | Gp0121239 | Ga0081196 |
| Sample Name | Microbial communities of Palythoa variabilis from marine subtidal rocky reef in Praia da Pedra Rachada, Paracuru, CE, Brazil |
| Sequencing Status | Permanent Draft |
| Sequencing Center | UNIVERSIDADE DE SAO PAULO |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 28662546 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Zoanthid-Associated Microbial Communities From Different Locations |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Invertebrates → Cnidaria → Unclassified → Unclassified → Marine Subtidal Rocky Reef → Zoanthid-Associated Microbial Communities From Different Locations |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal corpus |
| Location Information |
| Location | Praia da Pedra Rachada, Paracuru, CE, Brazil |
| Coordinates | Lat. (o) | -3.398594 | Long. (o) | -39.014155 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
| F007917 | Metagenome / Metatranscriptome | 342 | Y |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
| Ga0081196_1000028 | Ga0081196_10000282 | F007917 | MSKDGIVCLLMILNVNTYANVILERSLRANEGHIGVNESIMTVMKQIWTQMNVYFP* |