NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0101728_103932

Scaffold Ga0101728_103932


Overview

Basic Information
Taxon OID3300006654 Open in IMG/M
Scaffold IDGa0101728_103932 Open in IMG/M
Source Dataset NameCombined Assembly of Gp0125100, Gp0113270, Gp0125099
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterThe Marine Biological Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7206
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (54.55%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Abyssal Plane → Marine → Deep Marine Subsurface Microbial Communities From Mid-Atlantic Ridge (Iodp Expedition 336)

Source Dataset Sampling Location
Location NameNorth Pond, Atlantic Ocean
CoordinatesLat. (o)22.78Long. (o)-46.09Alt. (m)Depth (m)4350
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F085813Metagenome111N

Sequences

Protein IDFamilyRBSSequence
Ga0101728_1039322F085813N/AMDQFEIIWILVTVIGALNYGLNAYQKGFRRLLKWDVIXLIILNTLMFVPLSLIVVL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.