Basic Information | |
---|---|
Taxon OID | 3300006578 Open in IMG/M |
Scaffold ID | Ga0074059_10117272 Open in IMG/M |
Source Dataset Name | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1407 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Rhizosphere Microbial Communities From Centre Inrs-Institut Armand-Frappier, Laval, Canada |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Laval, Canada | |||||||
Coordinates | Lat. (o) | 45.54 | Long. (o) | -73.72 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F092001 | Metagenome / Metatranscriptome | 107 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0074059_101172721 | F092001 | N/A | MKPGMVDTKSIPKPGERWLSCPPYMLIAHVLEVVQGGGLPLVSYELQDDDGVVIERVDRAVLDDGWWQ |
⦗Top⦘ |