NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0100215_100616

Scaffold Ga0100215_100616


Overview

Basic Information
Taxon OID3300006568 Open in IMG/M
Scaffold IDGa0100215_100616 Open in IMG/M
Source Dataset NameHuman stool microbial communities from NIH, USA - visit 2 of subject 765074482 replicate 2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)42653
Total Scaffold Genes57 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)16 (28.07%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F055775Metagenome138N

Sequences

Protein IDFamilyRBSSequence
Ga0100215_1006165F055775N/ALVIEVATTAAALDGDTKKKLIECIEGGTITDVILVTKEVEKKISHARVVSWLVDTTGDSPKYTIDIIDAKSGAVEAIALN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.