Scaffold Ga0101390_1001006

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0101390_1001006

Scaffold Ga0101390_1001006

Overview

Basic Information
Taxon OID	3300006562 Open in IMG/M
Scaffold ID	Ga0101390_1001006 Open in IMG/M
Source Dataset Name	Marine microbial communities from the Black Sea in Odessa region - Od_2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Hellenic Centre for Marine Research (HCMR)
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	898
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Investigation Of Black Sea Water Bacterial Metagenome

Source Dataset Sampling Location
Location Name	Illichivsk, Odessa region, Ukraine
Coordinates	Lat. (^o)	46.302094	Long. (^o)	30.668915	Alt. (m)		Depth (m)	1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028043	Metagenome / Metatranscriptome	193	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0101390_10010062	F028043	N/A	MLILFTWANACEQEQVKPVDNKTIPVCEELQESTDEKPCKKPENINTVIKAIEKLGESGTLPK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.