NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0100250_100308

Scaffold Ga0100250_100308


Overview

Basic Information
Taxon OID3300006488 Open in IMG/M
Scaffold IDGa0100250_100308 Open in IMG/M
Source Dataset NameHuman supragingival plaque microbial communities from NIH, USA - visit number 1 of subject 675950834
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)17985
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (11.11%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F081454Metagenome114N
F101359Metagenome102N

Sequences

Protein IDFamilyRBSSequence
Ga0100250_10030812F101359N/AMKKFLSKRSILVGALALVLGFIVSSCSRDKDDDAIYTAKLQVQHHSNNSRNSTVNGSVTYRDANGNKRKIYLRSGMSESISFEVNKGFKSFVEVKATDIYGNLFVKWTVTKTYTGARVQNWSTSFTSYKGQDFMDSYKETVK*
Ga0100250_10030816F081454N/AMKAFKFILLLFITSASLVFGQEKRYFFKYEYLPNSKYLIKYKIDMDGGYKFVGNKEVLDKIGMDGVKMTINSDIESTFSTQKKQGENVPFILEYTKYFYEAEINGEKVNRKIPIQGVKLSGDIINGKKMEVKNVEGNIDEDTKKILIESIKQFSAIDTDFPKEGLKIGDSFDMVIPYKQSIPNAGDIEMKMNVKYKLLKVEKEEAYFDILIDFVMGDKNVKNMDLSASGDGKGFLLFDMKNNYFTNQNLDMTINLKLKTELLTLENTSKAKSIITQQKIK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.