NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0100240_112179

Scaffold Ga0100240_112179


Overview

Basic Information
Taxon OID3300006483 Open in IMG/M
Scaffold IDGa0100240_112179 Open in IMG/M
Source Dataset NameMicrobial communities from pig manure storage tank from Sherbrooke, QC, Canada, enriched culture C4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAgriculture and Agri-Food Canada
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3543
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Animal Waste → Unclassified → Unclassified → Manure → Microbial Communities From Manure Storage Tank From Sherbrooke, Qc, Canada

Source Dataset Sampling Location
Location NameSherbrooke, QC, Canada
CoordinatesLat. (o)45.4Long. (o)-71.9Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010099Metagenome / Metatranscriptome308Y

Sequences

Protein IDFamilyRBSSequence
Ga0100240_1121794F010099N/AMTYPQSSFWTPARIGAVIGAVLLVVALAYLVSLPQNQFQPADLLEPKYAADADLGYWMVNKYDPEVDVYHLLVVMQHDNGTFEWLDGDGIWLPRSAVEGTFNVIGTFDRRKAHL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.