Scaffold Ga0082251_10014232

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0082251_10014232

Scaffold Ga0082251_10014232

Overview

Basic Information
Taxon OID	3300006468 Open in IMG/M
Scaffold ID	Ga0082251_10014232 Open in IMG/M
Source Dataset Name	Deep-sea sediment bacterial and archaeal communities from Fram Strait - Combined Assembly of Gp0119454, Gp0119453, Gp0119452, Gp0119451
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Center for Biotechnology (CeBiTec), Bielefeld Univeristy
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2722
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment → Deep-Sea Sediment Bacterial And Archaeal Communities

Source Dataset Sampling Location
Location Name	Fram Strait
Coordinates	Lat. (^o)	77.978277	Long. (^o)	0.163645	Alt. (m)		Depth (m)	3500
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099485	Metagenome / Metatranscriptome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0082251_100142324	F099485	AGG	MKQQIIHNWQHSPSKTQVARTPVKAVSKPLRQSQTITNEDLMGLSWIMFEERD*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.