Scaffold Ga0100045_100558

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0100045_100558

Scaffold Ga0100045_100558

Overview

Basic Information
Taxon OID	3300006450 Open in IMG/M
Scaffold ID	Ga0100045_100558 Open in IMG/M
Source Dataset Name	Minimetagenome of a non-axenic cylindrospermopsis culture from a freshwater lake in Singapore
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Singapore Centre on Environmental Life Sciences Engineering (SCELSE)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	8089
Total Scaffold Genes	13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	11 (84.62%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Minimetagenome Of A Non-Axenic Cylindrospermopsis Culture From A Freshwater Lake In Singapore

Source Dataset Sampling Location
Location Name	Singapore
Coordinates	Lat. (^o)	1.3991438	Long. (^o)	103.77518	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051937	Metagenome	143	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0100045_1005585	F051937	AGGAG	MLTAEQVGGIVRAIMAALGGYAVGQGLTDAETMATIGGAVTTLAAAIWSIWAKRKAATE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.