3300006450: Minimetagenome of a non-axenic cylindrospermopsis culture from a freshwater lake in Singapore

Overview

Basic Information

• IMG/M Taxon OID: 3300006450
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0117458 | Gp0123955 | Ga0100045
• Sample Name: Minimetagenome of a non-axenic cylindrospermopsis culture from a freshwater lake in Singapore
• Sequencing Status: Permanent Draft
• Sequencing Center: Singapore Centre on Environmental Life Sciences Engineering (SCELSE)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 86447036
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Minimetagenome Of A Non-Axenic Cylindrospermopsis Culture From A Freshwater Lake In Singapore
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Minimetagenome Of A Non-Axenic Cylindrospermopsis Culture From A Freshwater Lake In Singapore

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: Singapore
• Coordinates
  • Lat. (^o): 1.3991438
  • Long. (^o): 103.77518
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051937	Metagenome	143	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0100045_100558	All Organisms → cellular organisms → Bacteria	8089

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0100045_100558	Ga0100045_1005585	F051937	MLTAEQVGGIVRAIMAALGGYAVGQGLTDAETMATIGGAVTTLAAAIWSIWAKRKAATE*