| Basic Information | |
|---|---|
| Taxon OID | 3300006409 Open in IMG/M |
| Scaffold ID | Ga0078977_101298 Open in IMG/M |
| Source Dataset Name | Viral communities from the deep bioline of CORK borehole observatory U136A, on the Juan de Fuca Ridge Flank, Pacific Ocean - passive in situ filtration, Fraction 20 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Hawaii |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1385 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Viruses Inhabiting Crustal Fluids Of The Juan De Fuca Ridge Flank |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Juan de Fuca Ridge Flank, Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 47.750184 | Long. (o) | -127.740187 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F042912 | Metagenome / Metatranscriptome | 157 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0078977_1012983 | F042912 | AGGTGG | MIYDYLDTIIALILVIGCFILLGLGIDTEVKSIITMAAGWAFGSQYQARKVRKR* |
| ⦗Top⦘ |