Basic Information | |
---|---|
Taxon OID | 3300006300 Open in IMG/M |
Scaffold ID | Ga0099592_10059651 Open in IMG/M |
Source Dataset Name | Prairie soil microbial communities from Kansas, USA, after rainfall - K06 |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Oregon State University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 535 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Prairie Soil → Prairie Soil Microbial Communities From Kansas, Usa, After Rainfall |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Konza Prairie, Kansas, USA | |||||||
Coordinates | Lat. (o) | 39.1038 | Long. (o) | -96.6133 | Alt. (m) | Depth (m) | .2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F004509 | Metagenome / Metatranscriptome | 435 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0099592_100596512 | F004509 | GAG | LQLINPSTLPNELNTTLTPHSIIHGDACFAYFNKIWGIP |
⦗Top⦘ |