3300006300: Prairie soil microbial communities from Kansas, USA, after rainfall - K06

Overview

Basic Information

• IMG/M Taxon OID: 3300006300
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0114560 | Gp0113277 | Ga0099592
• Sample Name: Prairie soil microbial communities from Kansas, USA, after rainfall - K06
• Sequencing Status: Permanent Draft
• Sequencing Center: Oregon State University
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 59489001
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Prairie Soil Microbial Communities From Kansas, Usa, After Rainfall
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Unclassified → Grasslands → Prairie Soil → Prairie Soil Microbial Communities From Kansas, Usa, After Rainfall

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): terrestrial biome → prairie → bulk soil
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: Konza Prairie, Kansas, USA
• Coordinates
  • Lat. (^o): 39.1038
  • Long. (^o): -96.6133
  • Alt. (m): N/A
  • Depth (m): .2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004509	Metagenome / Metatranscriptome	435	Y
F101805	Metagenome / Metatranscriptome	102	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0099592_10059651	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	535
Ga0099592_11090778	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	605

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0099592_10059651	Ga0099592_100596512	F004509	LQLINPSTLPNELNTTLTPHSIIHGDACFAYFNKIWGIP
Ga0099592_11090778	Ga0099592_110907782	F101805	MSTYLSTTDVFLAPTPEIRALHDKSILIVTPSGDQMWAKICVEDADPGGRDAGKCSVIVWTASTDEREWVDARSGRPPPPTESHRWPQFLTSDAVKLIRPNEENPAYDLLLQLATEEI*